PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04056.1.g00050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 294aa    MW: 31604.4 Da    PI: 10.143
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc04056.1.g00050.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.86e-191156147
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                                  +g+W++eEde l ++v+++G ++W++I r ++ gR++k+c++rw + 
  Zmw_sc04056.1.g00050.1.sm.mk 11 KGPWSPEEDEALRRLVERHGARNWTAIGRGIP-GRSGKSCRLRWCNQ 56
                                  79******************************.***********985 PP

2Myb_DNA-binding53.45.9e-1763106146
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                   r ++T+eEd  +++a+++ G++ W++Iar ++ gRt++ +k++w++
  Zmw_sc04056.1.g00050.1.sm.mk  63 RRPFTPEEDATILRAHAEIGNR-WAAIARLLP-GRTDNAVKNHWNS 106
                                   679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.481661IPR017930Myb domain
SuperFamilySSF466895.62E-328104IPR009057Homeodomain-like
SMARTSM007179.6E-171059IPR001005SANT/Myb domain
PfamPF002493.7E-181156IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-251264IPR009057Homeodomain-like
CDDcd001673.41E-161355No hitNo description
SMARTSM007171.6E-1562110IPR001005SANT/Myb domain
PROSITE profilePS5129420.97663112IPR017930Myb domain
PfamPF002493.0E-1563106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2465112IPR009057Homeodomain-like
CDDcd001673.30E-1265108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0010200Biological Processresponse to chitin
GO:0042742Biological Processdefense response to bacterium
GO:0046686Biological Processresponse to cadmium ion
GO:0050832Biological Processdefense response to fungus
GO:2000022Biological Processregulation of jasmonic acid mediated signaling pathway
GO:2000031Biological Processregulation of salicylic acid mediated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MGAEAECDRI KGPWSPEEDE ALRRLVERHG ARNWTAIGRG IPGRSGKSCR LRWCNQLSPQ  60
VERRPFTPEE DATILRAHAE IGNRWAAIAR LLPGRTDNAV KNHWNSSLKR KVVATATTEA  120
AAERPCKRVS PAPGSPTGSD RSELSHGSVG CGGAQVYRPV PRPGGFDTIR SANVRPAPSA  180
PTSGRDEDPL TSLSLSLPGQ DQQGSSGFRH DSARSHFQEL SPSRSPSPQP SHYPFSGELV  240
AAMQDMIRAE VRKYMSGVGL RAGCGPGAAG EKSIVEGVMR AAAERVGVVT SRQF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-4181124108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00653PBMTransfer from LOC_Os02g09480Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001147631.11e-147uncharacterized protein LOC100281240
SwissprotQ9FDW16e-73MYB44_ARATH; Transcription factor MYB44
TrEMBLB4FMQ31e-147B4FMQ3_MAIZE; MYB transcription factor
STRINGGRMZM2G145444_P011e-147(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154